Data Item _entity_poly.pdbx_seq_one_letter_code_can
Browse:
General 
- Item name
- _entity_poly.pdbx_seq_one_letter_code_can
- Category name
- entity_poly
- Attribute name
- pdbx_seq_one_letter_code_can
- Required in PDB entries
- no
- Used in current PDB entries
- Yes, in about 100.0 % of entries
Item Description
Canonical sequence of protein or nucleic acid polymer in standard
one-letter codes of amino acids or nucleotides,
corresponding to the sequence in
_entity_poly.pdbx_seq_one_letter_code. Non-standard
amino acids/nucleotides are represented by the codes of
their parents if parent is specified in
_chem_comp.mon_nstd_parent_comp_id, or by letter 'X' if
parent is not specified. Deoxynucleotides are
represented by their canonical one-letter codes of A,
C, G, or T.
For modifications with several parent amino acids,
all corresponding parent amino acid codes will be listed
(ex. chromophores).
Item Example
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGAAFNVEFD
Data Type 
- Data type code
- text
- Data type detail
- text item types / multi-line text ...
- Primitive data type code
- char
- Regular expression
- [][ \n\t()_,.;:"&<>/\{}'`~!@#$%?+=*A-Za-z0-9|^-]*
Aliases
| Alias Item Name | Dictionary Name | Dictionary Version |
|---|---|---|
| _entity_poly.ndb_seq_one_letter_code_can | cif_rcsb.dic | 1.1 |